Products

LEADGMP® IL-15 (Interleukin-15), Human

Download :
  • Catalog number
    62001GMP / 62002GMP
  • Package
    100 μg / 1 mg
  • Species
    Human
  • Endotoxin level
    <0.01 EU per 1 μg of the protein by the LAL method.
  • Formulation
    The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS with polyhistidine tag at the N-terminus.

Interleukin-15 (IL-15) is a 14–15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP1-), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes.

Measure by its ability to induce MO7e human megakaryocytic leukemic proliferation.
The ED50 for this effect is 0.5-3 ng/mL.
The specific activity of recombinant LeadGMP® human IL-15 is approximately 1.5 x 108 IU/mg.

Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.

SDS-PAGE analysis of LeadGMP® IL-15, Human
SDS-PAGE analysis of LeadGMP® IL-15, Human

  1. Keep ampoules at -20°C or -80°C for storage.
  2. No needs to spin the ampoule before opening. Remove the cap carefully.
  3. Dissolve the lyophilized protein by adding sterile ddH2O along the inner side of ampoule to avoid generating bubbles. Make protein concentration to be at 100 μg/mL, or consult product’s Certificate of Analysis (CoA). (Note: No needs to add carriers* to the initial reconstitution solution). Wear gloves when manipulating the sample to prevent contamination from proteases that may degrade the reconstituted protein.
  4. Leave the reconstituted protein solution at room temperature for at least 20 minutes.
  5. Pipet the solution gently. The solution should be clear if proteins are fully dissolved. (Important Note: Do Not Vortex! Vigorous shaking may impair biological activity of protein.)
  6. Use the reconstituted solution immediately, or make aliquots and store at -20 °C. (Important Note: Avoid repeated freeze-thaw cycles)
  7. We recommend diluting the initial reconstitution solution to working concentration with buffers or medium containing carriers*. (Important Note: Do not use water for dilution, which may cause protein degradation.)

*Carriers: 0.1% BSA, 5% HSA or 10% FBS.

1. Abadie V, Jabri B. (2014) Immunol Rev. 260,1: 221-34.
2. Patidar, M. et al. (2016) Cytokine Growth Factor Rev. 31: 49-59.
3. Guo, Y. et al. (2017) Cytokine Growth Factor Rev. 38: 10-21.
4. Perera, P. et al. (2012) Microbes Infect. 14(3): 247–261.

More Products

LEADGMP® IL-15 (Interleukin-15), Human

Shopping cart
  • LEADGMP® IL-15 (Interleukin-15), Human
  • Spec

    62001GMP / 100 μg

  • Unit Price:

    US$1400

  • Qty:

    +

Quote Cancel Inquiry Next
Back
Top