Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS with polyhistidine tag at the N-terminus.
Interleukin-15 (IL-15) is a 14–15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP1-), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes.
Measure by its ability to induce proliferation in CTLL-2 cells. The ED50 for this effect is <3 ng/mL. The specific activity of recombinant LeadGMP® human IL-15 is approximately 2 x 106 IU/mg.
Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.
*Carriers: 0.1% BSA, 5% HSA or 10% FBS.
1. Abadie V, Jabri B. (2014) Immunol Rev. 260,1: 221-34.
2. Patidar, M. et al. (2016) Cytokine Growth Factor Rev. 31: 49-59.
3. Guo, Y. et al. (2017) Cytokine Growth Factor Rev. 38: 10-21.
4. Perera, P. et al. (2012) Microbes Infect. 14(3): 247–261.
62001GMP / 100 μg
US$1400