Products

LEADGENE® CXCL5 (C-X-C Motif Chemokine 5), Human

Download :
  • Catalog number
    66811 / 66812 / 66813
  • Package
    5 μg / 20 μg / 100 μg
  • Species
    Human
  • Tag
    polyhistidine tag at the N-terminus
  • Endotoxin level
    <0.1 EU per 1 μg of the protein by the LAL method.
  • Formulation
    The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Escherichia coli

RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN with polyhistidine tag at the N-terminus.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2.
The ED50 for this effect is <10 ng/mL.

Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.

  1. Keep ampoules at -20°C or -80°C for storage.
  2. No needs to spin the ampoule before opening. Remove the cap carefully.
  3. Dissolve the lyophilized protein by adding sterile ddH2O along the inner side of ampoule to avoid generating bubbles. Make protein concentration to be at 100 μg/mL, or consult product’s Certificate of Analysis (CoA). (Note: No needs to add carriers* to the initial reconstitution solution). Wear gloves when manipulating the sample to prevent contamination from proteases that may degrade the reconstituted protein.
  4. Leave the reconstituted protein solution at room temperature for at least 20 minutes.
  5. Pipet the solution gently. The solution should be clear if proteins are fully dissolved. (Important Note: Do Not Vortex! Vigorous shaking may impair biological activity of protein.)
  6. Use the reconstituted solution immediately, or make aliquots and store at -20 °C. (Important Note: Avoid repeated freeze-thaw cycles)
  7. We recommend diluting the initial reconstitution solution to working concentration with buffers or medium containing carriers*. (Important Note: Do not use water for dilution, which may cause protein degradation.)

*Carriers: 0.1% BSA, 5% HSA or 10% FBS.

More Products

LEADGENE® CXCL5 (C-X-C Motif Chemokine 5), Human

Shopping cart
  • LEADGENE® CXCL5 (C-X-C Motif Chemokine 5), Human
  • Spec

    66811 / 5 μg

  • Unit Price:

    US$99

  • Qty:

    +

Quote Cancel Inquiry Next
Back
Top