Products

LEADGENE® SARS-CoV-2 Trimeric Spike Protein (Beta B1.351 Variant), His Tag, HEK293

Download :
  • Catalog number
    63531 / 63532 / 63533 / 63534
  • Package
    5 μg / 20 μg / 100 μg / 1 mg
  • Sequence

    SQCVNFTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFANPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRGLPQGFSALEPLVDLPIGINITRFQTLHISYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIA
    DTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSP
    RRARSVASQSIIAYTMSLGVENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWP with polyhistidine tag at the C-terminus.

  • Concentration
    Please refer to the product label.
  • Form
    Liquid

>95% as determined by SDS-PAGE analysis.
Purified by Ni-NTA chromatography

<0.1 EU per 1 μg of the protein by the LAL method.

  1. Keep ampoules at -20°C or -80°C for storage.
  2. No needs to spin the ampoule before opening. Remove the cap carefully.
  3. Dissolve the lyophilized protein by adding sterile ddH2O along the inner side of ampoule to avoid generating bubbles. Make protein concentration to be at 100 μg/mL, or consult product’s Certificate of Analysis (CoA). (Note: No needs to add carriers* to the initial reconstitution solution). Wear gloves when manipulating the sample to prevent contamination from proteases that may degrade the reconstituted protein.
  4. Leave the reconstituted protein solution at room temperature for at least 20 minutes.
  5. Pipet the solution gently. The solution should be clear if proteins are fully dissolved. (Important Note: Do Not Vortex! Vigorous shaking may impair biological activity of protein.)
  6. Use the reconstituted solution immediately, or make aliquots and store at -20 °C. (Important Note: Avoid repeated freeze-thaw cycles)
  7. We recommend diluting the initial reconstitution solution to working concentration with buffers or medium containing carriers*. (Important Note: Do not use water for dilution, which may cause protein degradation.)

*Carriers: 0.1% BSA, 5% HSA or 10% FBS.

Phosphate buffered saline, pH 7.4.

Stored at -80°C.
This product should be used and stored under sterile condition.
Avoid repeated free-thaw cycles.

SDS-PAGE and Western blot analysis of SARS-CoV-2 Trimeric Spike Protein (Beta B1.351 Variant), His Tag, HEK293 Primary antibody : Mouse anti-His tag mAb (Leadgene Cat. 10410); Secondary antibody : Goat anti-Mouse IgG (H +L)-HRP (Leadgene Cat. 20102)
SDS-PAGE and Western blot analysis of SARS-CoV-2 Trimeric Spike Protein (Beta B1.351
Variant), His Tag, HEK293
Primary antibody : Mouse anti-His tag mAb (Leadgene Cat. 10410);
Secondary antibody : Goat anti-Mouse IgG (H +L)-HRP (Leadgene Cat. 20102)

More Products

LEADGENE® SARS-CoV-2 Trimeric Spike Protein (Beta B1.351 Variant), His Tag, HEK293

Shopping cart
  • LEADGENE® SARS-CoV-2 Trimeric Spike Protein (Beta B1.351 Variant), His Tag, HEK293
  • Spec

    63531 / 5 μg

  • Unit Price:

    US$

  • Qty:

    +

Join inquiry Cancel Inquiry Next
Back
Top
小圖示廣告