Products

LEADGMP® IL-4 (Interleukin-4), Human

Download :
  • Catalog number
    60901GMP / 60902GMP
  • Package
    100 μg / 1 mg
  • Species
    Human
  • Tag
    polyhistidine tag at the C-terminus
  • Endotoxin level
    <0.1 EU per 1 μg of the protein by the LAL method.
  • Formulation
    The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline

MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS with polyhistidine tag at the C-terminus.

Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch.

Measure by its ability to induce TF-1 cells proliferation.
The ED50 for this effect is <0.2 ng/mL.
The specific activity of recombinant human IL-4 is approximately >2.8 x 107 IU/mg.

Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.

SDS-PAGE analysis of LeadGMP® IL-4, Human
SDS-PAGE analysis of LeadGMP® IL-4, Human

1. Junttila IS. (2018) Front Immunol. 9: 888.
2. Ho IC, Miaw SC. (2016) Adv Exp Med Biol. 941: 31‐77.
3. Brown MA, Hural J. (2017) Crit Rev Immunol. 37,2-6: 181-212.
4. Luzina, IG. et al. (2012) J Leukoc Biol. 92,4: 753-64.

  1. Keep ampoules at -20°C or -80°C for storage.
  2. No needs to spin the ampoule before opening. Remove the cap carefully.
  3. Dissolve the lyophilized protein by adding sterile ddH2O along the inner side of ampoule to avoid generating bubbles. Make protein concentration to be at 100 μg/mL, or consult product’s Certificate of Analysis (CoA). (Note: No needs to add carriers* to the initial reconstitution solution). Wear gloves when manipulating the sample to prevent contamination from proteases that may degrade the reconstituted protein.
  4. Leave the reconstituted protein solution at room temperature for at least 20 minutes.
  5. Pipet the solution gently. The solution should be clear if proteins are fully dissolved. (Important Note: Do Not Vortex! Vigorous shaking may impair biological activity of protein.)
  6. Use the reconstituted solution immediately, or make aliquots and store at -20 °C. (Important Note: Avoid repeated freeze-thaw cycles)
  7. We recommend diluting the initial reconstitution solution to working concentration with buffers or medium containing carriers*. (Important Note: Do not use water for dilution, which may cause protein degradation.)

*Carriers: 0.1% BSA, 5% HSA or 10% FBS.

More Products

LEADGMP® IL-4 (Interleukin-4), Human

Shopping cart
  • LEADGMP® IL-4 (Interleukin-4), Human
  • Spec

    60901GMP / 100 μg

  • Unit Price:

    US$960

  • Qty:

    +

Quote Cancel Inquiry Next
Back
Top