Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS with polyhistidine tag at the C-terminus.
Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch.
Measure by its ability to induce TF-1 cells proliferation.
The ED50 for this effect is <0.2 ng/mL.
The specific activity of recombinant human IL-4 is approximately >2.8 x 107 IU/mg.
Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.
1. Junttila IS. (2018) Front Immunol. 9: 888.
2. Ho IC, Miaw SC. (2016) Adv Exp Med Biol. 941: 31‐77.
3. Brown MA, Hural J. (2017) Crit Rev Immunol. 37,2-6: 181-212.
4. Luzina, IG. et al. (2012) J Leukoc Biol. 92,4: 753-64.
*Carriers: 0.1% BSA, 5% HSA or 10% FBS.
60901GMP / 100 μg
US$960