Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline
MAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF with polyhistidine tag at the C-terminus.
Interleukin-3 (IL-3) is a pleiotropic cytokine which can stimulates the survival, differentiation and proliferation of committed progenitor cells, including megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. IL-3 also enhances phagocytosis and antibody-mediated cellular cytotoxicity. IL-3 binds to IL-3R (IL-3 receptor), which is composed of a unique α subunit (IL-3Rα) and a common β-subunit (βc).
Measure by its ability to induce TF-1 cells proliferation.
The ED50 for this effect is <0.15 ng/mL.
The specific activity of recombinant human IL-3 is approximately >1.2 x 106 IU/mg.
Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.
1. Wagemaker G et al. (1990) Biotherapy. 2,4: 337-45.
2. Guthridge MA. et al. (1998) Stem Cells. 16,5: 301-13.
3. Ihle JN. (1992) Chem Immunol. 51: 65-106.
4. Dougan M. et al. (2019) Immunity. 50,4: 796-811.
*Carriers: 0.1% BSA, 5% HSA or 10% FBS.
60801GMP / 100 μg
US$1450